Cat. No.: 41550 | Other Names: SmD3, snRNPD3 |
Species: Human | Size: 0.1mg |
Origin: Recombinant | Tag: N-terminal 6xHis |
Source: Spodoptera frugiperda Sf9 | Purity: >90% |
Introduction
Small nuclear ribonucleoprotein complexes (abbreviated as U-snRNP) are essential for splicing of precursor mRNA molecules.
Seven different Sm proteins aggregate into a heteroheptameric protein core, including small nuclear ribonucleoprotein Sm D3
(SmD3 or snRNPD3). In the blood of patients with systemic lupus erythematosus, antinuclear antibodies are developed with Sm
specificity.
Immunological Function
As an autoantigen, SmD3 binds with IgG-type human auto-antibodies.
Amino Acid Sequence
MSYYHHHHHHDYDIPTTENLYFQGASIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRD
GRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR
Applications
Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.
Formulation
Liquid in storage buffer(50mM Tris, 150mM NaCl, 400mM L-Arginine, 2mM Reduced GSH, 0.2mM Oxidized GSSG, Protease
inhibitor, pH 7.4).
Description
Expressed in insect Sf9 cells with a total of 155 AA.
Mw: 16.9 KDa (calculated).
N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).
Recombinant antigen for research use or manufacturing only.
Storage
Store at –80°C. Avoid repeated freezing /thawing cycles.
Quality Control Test
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.