Cat. No.: 41810 | Other Names: H2A |
Species: Human | Size: 0.1mg |
Origin: Recombinant | Tag: N-terminal 6xHis |
Source: E.coli | Purity: >90% |
Introduction
Histones are proteins that package DNA into nucleosomes and are responsible for maintaining the shape and structure of
anucleosome. There are five families of histones known to date, H1/H5, H2A, H2B, H3, and H4. H2A, along with H2B, H3 and H4, is considered as a core histone. Anti-histone autoantibodies are found in 50%-70% of patients with systemic lupus
erythematosus (SLE) and in more than 95% of patients with drug-induced lupus erythematosus.
Immunological Function
As an autoantigen, H2A binds with IgG-type human auto-antibodies.
Amino Acid Sequence
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSENLYFQGASGRGKQGGKARAKAKSRSSRAGLQFP
VGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQ
GGVLPNIQAVLLPKKTESHHKAKGK
Applications
Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.
Formulation
Liquid in storage buffer (50mM Tris, 300-500mM NaCl, 10% Glycerol, Protease inhibitor, pH8.0).
Description
Expressed in E.coli cells with a total of 173 AA.
Mw: 19.0 KDa (calculated).
N-terminal 6xHis-tag, Xpress Epitope, EK recognition site, and TEV cleavage site, 44 extra AA (highlighted).
Recombinant antigen for research use or manufacturing only.
Storage
Store at –80°C. Avoid repeated freezing /thawing cycles.
Quality Control Test
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.