Cat. No.: 41820 | Other Names: H2B |
Species: Human | Size: 0.1mg |
Origin: Recombinant | Tag: N-terminal 6xHis |
Source: E.coli | Purity: >90% |
Introduction
Histones are proteins that package DNA into nucleosomes and are responsible for maintaining the shape and structure of a
nucleosome. There are five families of histones known to date, H1/H5, H2A, H2B, H3, and H4. H2B, along with H2A, H3 and H4, is
considered as a core histone. Anti-histone autoantibodies are found in 50%-70% of patients with systemic lupus
erythematosus (SLE) and in more than 95% of patients with drug-induced lupus erythematosus.
Immunological Function
As an autoantigen, H2B binds with IgG-type human auto-antibodies.
Amino Acid Sequence
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSENLYFQGAPEPAKSAPAPKKGSKKAVTKAQKKDGKK
RKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELA
KHAVSEGTKAVTKYTSSK
Applications
Standard ELISA test, line/dot assay and microarray assay with positive/negative sera panels.
Formulation
Liquid in storage buffer (50mM Tris, 300-500mM NaCl, 10% Glycerol, Protease inhibitor, pH8.0).
Description
Expressed in E.coli cells with total 169 AA.
Mw: 18.84 KDa (calculated).
N-terminal 6xHis-tag, Xpress Epitope, EK recognition site and TEV cleavage site, 44 extra AA (highlighted).
Recombinant antigen for research use or manufacturing only.
Storage
Store at –80°C. Avoid repeated freezing /thawing cycles.
Quality Control Test
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.