|
|
|
|
|
|
|
|
Introduction
Interleukin-13 (IL-13) is a monomeric 17 kDa immunoregulatory cytokine that plays a key role in the pathogenesis of allergy, cancer, and tissue fibrosis. It is secreted by several helper T cell subsets, NK cells, mast cells, eosinophils, basophils, and visceral smooth
muscle cells. IL-13 suppresses the production of proinflammatory cytokines and other cytotoxic substances by macrophages,
fibroblasts, and endothelial cells. On B cells, it promotes cellular activation, immunoglobulin class switching to IgE, and the up‑
regulation of CD23/Fc epsilon RII.
Description
Expressed in E.coli with total 135 AA. Mw: 15.2 KDa (calculated).
N-terminal 6xHis-tag and TEV cleavage site, 25 extra AA (highlighted).
Recombinant antigen for research use or manufacturing only.
Amino Acid Sequence
MSYYHHHHHHDYDIPTTENLYFQGAPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSL
TNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Formulation
Lyophilized at 1 mg/mL in NaCl 500mM, KCl 2.7mM, Na2HPO4 10mM, KH2PO4 1.8mM, pH 7.0.
Reconstitution
Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolves completely.
Storage
Store lyophilized protein at -20°C. Aliquot reconstituted protein and store at -80°C. Avoid repeated freezing/thawing cycles.
Quality Control Test
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.
Application
ELISA and Western Blotting.
Endotoxin Level
<0.2 EU per 1 μg of the protein by the LAL method.