Type: Recombinant | Cat. No.: 41359 |
Tag: Tagless (his-tag removed) | Size: 0.1 mg |
Source: E.Coli | Purity: >95% |
Other names: Irisin | Species: Human |
Introduction
Exercise enhances muscular endurance and strength, calories expenditure, and prevents the development of obesity and type 2
diabetes. These effects of exercise cannot be explained solely by the expenditure of calories in muscle. A recent study indicated that a novel hormone, irisin, plays an important role in the increase of total body energy expenditure by exercising muscle. Irisin is a
cleaved and secreted fragment of a membrane protein FNDC5. And its circulating concentrations are increased after regular physical activity. Exercise induces the transcriptional regulator PGC-1α in the skeletal myocyte, which in turn drives the production of the
FNDC5. Animal experiments suggested that irisin, cleaved form FNDC5, activates thermogenic programs in white adipose
tissue (“browning”), including mitochondrial biogenesis and the expression of uncoupling protein 1 (UCP1), leading to mitochondrial
heat production and energy expenditure. Irisin is highly conserved across species, and exercise also increases circulating irisin
concentrations in humans. Therefore, the role of irisin in humans may be that it links physical activity to energy metabolic
homeostasis, including weight control.
Description
The recombinant irisin is the extracellular domain of FNDC5 (Asp16 to Thr136). Total 126 AA. Mw: 14kDa (calculated).
N-terminal His-tag removed, 5 extra AA left (highlighted).
Amino Acid Sequence
GAMGSDSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLE
EDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRT
Formulation
Lyophilized in 1 mg/mL in PBS.
Reconstitution
Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolves completely.
Storage
Store lyophilized protein at -20°C. Aliquot reconstituted protein and store at -80°C. Avoid repeated freezing/thawing cycles.
Quality Control Test
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.
Application
ELISA and Western Blotting.