|
|
|
|
|
|
|
|
Introduction
FGF2, also called FGF basic, is a member of the FGF family of at least 23 related mitogenic proteins which has been isolated from
a number of sources, including neural tissue, pituitary, adrenal cortex, corpus luteum, and placenta. FGF2 stimulates the proliferation of all cells of mesodermal origin and many cells of neuroectodermal, ectodermal, and endodermal origin. Besides, FGF2 induces
neuron differentiation, survival, regeneration, and also modulates embryonic development and differentiation. These observed in vitro functions of FGF2 suggest FGF2 may play a role in vivo in the modulation of such normal processes as angiogenesis, wound
healing and tissue repair, embryonic development and differentiation, and neuronal function and neural degeneration. Additionally,
FGF basic may participate in the production of a variety of pathological conditions resulting from excessive cell proliferation and
excessive angiogenesis.
Description
Expressed in E.coli with total 193 AA. Mw: 21.8 KDa (calculated).
N-terminal 6xHis-tag, EK recognition site and TEV cleavage site, 47 extra AA (highlighted).
Recombinant antigen for research use or manufacturing only.
Amino Acid Sequence
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELEENLYFQGAPALPEDGGSGAFPP
GHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKED
GRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Formulation
Lyophilized in 20mM phosphate, 0.01mM heparin and 500mM NaCl.
Reconstitution
Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolves completely.
Storage
Store lyophilized protein at -20°C. Aliquot reconstituted protein and store at -80°C. Avoid repeated freezing/thawing cycles.
Quality Control Test
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.
Application
Standard ELISA test, Western Blot, functional study.
Endotoxin Level
<0.2 EU per 1 μg of the protein by the LAL method.