Origin: Recombinant | Cat. No.: 41284 |
Tag: No tag | Size: 0.1 mg |
Source: E.coli | Purity: >90% |
Other Names: FGF-19 | Species: Human |
Introduction
Fibroblast growth factor 19 (FGF-19) is a member of a subfamily of FGFs that includes FGF-21 and FGF- 23, each member
functions as an important regular of nutrient metabolism. The primary source of endocrine FGF-19 is the ileum, bile acids release
into the intestine after a meal to induce expression of FGF-19. Circulating FGF-19 plays an important role in maintaining proper bile acid homeostasis. Several pharmacologic studies in hyperglycaemic, obese animal models have shown that FGF-19 can improve
metabolic rate and lower serum glucose and hepatic triglyceride and cholesterol levels. Like insulin, FGF-19 functions as
postprandial hormone to govern hepatic protein synthesis, glycogen synthesis and gluconeogenesis, but does not stimulate
lipogenesis.
Description
Expressed in E.coli cells with total 194 AA. Mw: 21.6 KDa (calculated).
No tag, but with 2 extra AA at N-terminal (highlighted).
Recombinant antigen for research use or manufacturing only.
Amino Acid Sequence
GALAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Formulation
Lyophilized at 1 mg/mL in storage buffer (50mM Tris, 300-500mM NaCl, 10% Glycerol, PH8.0).
Reconstitution
Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolves completely.
Storage
Store lyophilized protein at -20°C. Aliquot reconstituted protein and store at -80°C. Avoid repeated freezing/thawing cycles.
Quality Control Test
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.
Application
ELISA and Western Blotting.
Endotoxin Level
<0.2 EU per 1 μg of the protein by the LAL method.