|
|
|
|
|
|
|
|
Introduction
FGF-23 is a bone-derived hormone that acts in the kidney to regulate phosphate homeostasis and vitamin D metabolism. The
signaling receptor for FGF-23, ɑ Klotho-FGFR1 (IIIc) complex, is an essential regulator of the renal sodium phosphate co-transporter
and key vitamin D-metabolizing enzymes CYP27B1 and CYP24A1. Mature human FGF-23 contains an atypical (very low affinity)
heparin binding site (aa 134-162), a proteolytic cleavage site (Arg179-Ser180), and multiple O-linked glycosylation sites with Thr178
being of particular importance. O-linked glycosylation at Thr178 blocks the cleavage of FGF-23, thereby preventing loss of FGF-23
activity. This recombinant human FGF23 bears mutation at 179th aa from arginine to glutamine preventing proteolytic cleavage.
Description
Expressed in E.coli with total 271 AA. Mw: 30.4 KDa (calculated).
N-terminal 6xHis-tag, EK and TEV cleavage site, 44 extra AA (highlighted).
Recombinant antigen for research use or manufacturing only.
Amino Acid Sequence
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSENLYFQGAYPNASPLLGSSWGGLIHLYTATARNSYHLQ
IHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQ
YHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMTPAPASCSQE
LPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
Formulation/Reconstitution
Lyophilized at 1 mg/mL in 50mM Tris, 300mM NaCl, 400mM arginine.
Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.
Storage
Store lyophilized protein at -20°C. Aliquot reconstituted protein and store at -80°C. Avoid repeated freezing/thawing cycles.
Quality Control Test
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.
Application
Standard ELISA test, Western Blot.