|
|
|
|
|
|
Introduction
Oncostatin M (OSM) is a glycoprotein belonging to the interleukin-6 family of cytokines that has functions mainly in cell growth. It is
considered as a pleiotropic cytokine that signals through cell surface receptors type I and type II both of which share the similarity of containing protein gp13 and takes part in many biological processes including liver development, haematopoeisis, inflammation,
bone formation and destruction and possibly CNS development. Human OSM protein is used in the differentiation of human
pluripotent stem cells into hepatocyte-like cells. OSM also plays roles in osteogenesis and neurogenesis and is an important
regulator of the hematopoietic stem cell niche in the bone marrow.
Description
Recombinant human Oncostatin M without signal peptide and propeptide (AA26-221), total 197 amino acids (AA). N-terminal His-tag removed. Mw: 22.2 kDa (calculated). 1 extra AA left (In bold).
Amino Acid Sequence
AAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR
Formulation
Lyophilized in 1 mg/mL in PBS.
Reconstitution
Add sterile deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve
completely.
Storage
Store at –20°C. Avoid repeated freezing/thawing cycles.
Application
Cell culture, animal studies, ELISA and Western blotting.
Endotoxin Level
<0.2 EU/ug.