Origin:Recombinant |
|
|
|
|
|
|
|
Introduction
GDF-15 plays an important role in tumorigenesis and metastasis. It has been observed that in many types of cancers, such as
colorectal, breast, and prostate, the expression of GDF-15 is dramatically increased. Additionally, in cancer patients, serum levels of
GDF-15 are elevated, which are of value in disease diagnosis and stratification. GDF-15 is strongly induced by the tumor suppressor
gene p53 and other anti- tumorigenic agents, such as the non-steroidal anti-inflammatory drugs and peroxisome proliferators
activated receptor γ. These findings suggest that GDF-15 may be a downstream target of those signaling pathways that regulate cell
cycle arrest and apoptosis. Through the modulation of neuronal pathways important in the regulation of appetite and energy
homeostasis, GDF-15 mediates cancer-induced anorexia and weight loss.
Structure/Activity
Disulfide-linked homodimer.
10nM of recombinant hGDF15 is able to activate AKT and ERK phosphorylation in HEK293 cells co-transfected with the GDF15
receptor complex GFRAL and RET51.
Amino Acid Sequence
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSENLYFQGARNGDHCPLGPGRCCRLHTVRASLEDLGW
ADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTG VSLQTYDDLLAKDCHCI
Formulation
Lyophilized in a solution containing 50mM Na2HPO4 and 500mM NaCl, pH 8.0.
Reconstitution
1. Briefly centrifuge before opening the vial.
2. Add 200µl sterile deionized water to prepare a stock solution of approximately 0.1 mg/mL and let the lyophilized pellet dissolve
completely.
Storage
Store lyophilized protein at -20°C. Aliquot reconstituted protein and store at -80°C. Avoid repeated freezing/thawing cycles.
Quality Control Test
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.
Application
ELISA and Western Blotting.
Endotoxin Level
<0.01EU per 1µg of protein by LAL method.